Recombinant Mouse Macrophage Inflammatory Protein 1 gamma

Target Information

Sequence	MQITHATETKEVQSSLKAQQGLEIEMFHMGFQDSSDCCLSYNSRIQCSRF IGYFPTSGGCTRPGIIFISKRGFQVCANPSDRRVQRCIERLEQNSQPRTY KQ
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	22 to 122
Cellular Localization	Secreted.
Tissue Specificity	Expressed mainly in the liver, lung, and the thymus, although some expression has been detected in a wide variety of tissues except brain.
Function	Monokine with inflammatory, pyrogenic and chemokinetic properties. Circulates at high concentrations in the blood of healthy animals. Binding to a high-affinity receptor activates calcium release in neutrophils. It also inhibits colony formation of bone marrow myeloid immature progenitors.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	12 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.