Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse Macrophage Inflammatory Protein 1 alpha / CCL3

Cat. No.: IBDP-530453

Size:

Target Information

Sequence APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQIC ADSKETWVQEYITDLELNA
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 24 to 92
Cellular Localization Secreted.
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Product Details

Product Type Protein
Species Mouse
Source E. coli
Endotoxin Level ≤1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 8 kDa
Purity >95%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.