Recombinant Mouse M-CSF Protein

Target Information

Sequence	MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVD QEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATER LQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLE KDWNIFTKNCNNSFAKCSSRDVVTKP
Amino Acids	33 to 187
Cellular Localization	Cell membrane and Secreted > extracellular space.
Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Protein Length	Protein fragment
Molecular Weight	36 kDa
Purity	>98%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.