Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse IL-9 Protein

Cat. No.: IBDP-530533

Size:

Target Information

Synonyms rMuIL-9|||Cytokine P40|||T-cell Growth Factor P40
Sequence QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Function IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family. IL-9 Protein, Mouse (CHO) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Product Details

Product Type Protein
Species Mouse
Source CHO Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 28-42 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.