Cat. No.: IBDP-530533
Size:
Online InquiryTarget Information
Synonyms | rMuIL-9|||Cytokine P40|||T-cell Growth Factor P40 |
Sequence | QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP |
Function | IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family. IL-9 Protein, Mouse (CHO) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | CHO Cells |
Tag | 6*His |
Endotoxin Level | <1.0 Eu/µg |
Molecular Weight | 28-42 kDa |
Purity | ≥95% |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |