Cat. No.: IBDP-530424
Size:
Online InquiryTarget Information
| Synonyms | rMuIL-7|||LP-1|||pre-B cell factor |
| Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH |
| Function | IL-7 Protein, Mouse (CHO) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | CHO Cells |
| Tag | His |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 8-28 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |