Cat. No.: IBDP-530359
Size:
Online InquiryTarget Information
Sequence | MFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGN SDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSY LEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNAL LTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT |
Sequence Similarities | Belongs to the IL-6 superfamily. |
Amino Acids | 25 to 211 |
Cellular Localization | Secreted. |
Function | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | E. coli |
Endotoxin Level | ≤1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 22 kDa |
Purity | >95% |
Active | Yes |
Animal free | Yes |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |