Cat. No.: IBDP-530358
Size:
Online InquiryTarget Information
| Sequence | FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNS DCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYL EYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALL TDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQTHHHHHH |
| Sequence Similarities | Belongs to the IL-6 superfamily. |
| Amino Acids | 25 to 211 |
| Cellular Localization | Secreted. |
| Function | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | Insect Cells |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 23 kDa |
| Purity | >95% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |