Cat. No.: IBDP-530342
Size:
Online InquiryTarget Information
| Synonyms | Interleukin-4|||B-cell IgG differentiation factor|||B-cell growth factor 1|||B-cell stimulatory factor 1|||IGG1 induction factor|||Lymphocyte stimulatory factor 1|||IL-4|||BSF-1 |
| Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Function | IL-4 Protein, Mouse is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 12-15 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |