Cat. No.: IBDP-530207
Size:
Online InquiryTarget Information
| Sequence | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRV NLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH |
| Sequence Similarities | Belongs to the IL-3 family. |
| Amino Acids | 27 to 166 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Activated T-cells, mast cells, natural killer cells. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | Baculovirus Infected Insect Cells |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 17 kDa |
| Purity | >90% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |