Cat. No.: IBDP-530210
Size:
Online InquiryTarget Information
| Synonyms | rMuIL-3|||Hematopoietic growth factor|||Mast cell growth factor|||MCGF|||Multipotential colony-stimulating factor|||P-cell-stimulating factor |
| Sequence | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Function | IL-3 Protein, Mouse is a pleiotropic cytokine containing 135 amino acids, which functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 15.2 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |