Cat. No.: IBDP-530211
Size:
Online InquiryTarget Information
| Synonyms | Interleukin-3|||IL-3|||Hematopoietic growth factor|||Multipotential colony-stimulating factor|||P-cell-stimulating factor|||Il3|||Il-3|||Mast cell growth factor|||MCGF |
| Sequence | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Function | IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 15-32 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |