Cat. No.: IBDP-531228
Size:
Online InquiryTarget Information
Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQS LTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 28 to 100 |
Cellular Localization | Secreted. |
Function | Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | E. coli |
Tag | His |
Protein Length | Full length protein |
Molecular Weight | 11 kDa |
Purity | >90% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | MS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |