Cat. No.: IBDP-530887
Size:
Online InquiryTarget Information
| Synonyms | rMuFlt-3 Ligand, His|||Fms-related tyrosine kinase 3 ligand|||SL cytokine|||Flt3lg |
| Sequence | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH |
| Function | FLT3LG Protein, Mouse (CHO, His) is a ligand of mouse Flt-3, induces proliferation of haematopoietic progenitor cells. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | CHO Cells |
| Tag | His |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 24-30 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |