Cat. No.: IBDP-530970
Size:
Online InquiryTarget Information
| Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAES VGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISK KHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Amino Acids | 16 to 155 |
| Cellular Localization | Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1. |
| Function | The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 16 kDa |
| Purity | ≥95% |
| Active | No |
| Animal free | Yes |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |