Recombinant Mouse Eotaxin Protein

Target Information

Sequence	HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEIC ADPKKKWVQDATKHLDQKLQTPKP
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 97
Cellular Localization	Secreted.
Function	In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Protein Length	Full length protein
Molecular Weight	8 kDa
Purity	>96%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.