Cat. No.: IBDP-531232
Size:
Online InquiryTarget Information
| Synonyms | rMuDCIP-1/CXCL3|||C-X-C motif chemokine 3|||Dendritic cell inflammatory protein 1 |
| Sequence | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Function | DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | CHO Cells |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 11.19 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |