Cat. No.: IBDP-531231
Size:
Online InquiryTarget Information
Synonyms | rMuCXCL3|||C-X-C motif chemokine 3|||Dendritic cell inflammatory protein 1|||DCIP-1 |
Sequence | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Function | CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. DCIP-1/CXCL3 Protein, Mouse is produced in E. coli , and consists of 73 amino acids (A28-S100). |
Product Details
Product Type | Protein |
Species | Mouse |
Source | E. coli |
Tag | Tag Free |
Endotoxin Level | <1.0 Eu/µg |
Molecular Weight | 10 kDa |
Purity | ≥95% |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |