Cat. No.: IBDP-530481
Size:
Online InquiryTarget Information
| Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 25 to 96 |
| Cellular Localization | Secreted. |
| Function | Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 11 kDa |
| Purity | >99% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |