Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse CXCL16 Protein

Cat. No.: IBDP-531271

Size:

Target Information

Sequence NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSK SVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEG TPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPE AEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
Sequence Similarities Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids 27 to 201
Cellular Localization Cell membrane. Secreted. Also exists as a soluble form.
Tissue Specificity Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
Function Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.

Product Details

Product Type Protein
Species Mouse
Source Mammalian
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Protein fragment
Molecular Weight 20 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.