Recombinant Mouse CXCL16 Protein

Target Information

Sequence	NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSK SVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEG TPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPE AEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
Sequence Similarities	Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids	27 to 201
Cellular Localization	Cell membrane. Secreted. Also exists as a soluble form.
Tissue Specificity	Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
Function	Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.

Product Details

Product Type	Protein
Species	Mouse
Source	Mammalian
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Protein fragment
Molecular Weight	20 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.