Cat. No.: IBDP-530120
Size:
Online InquiryTarget Information
| Sequence | QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFC ADPKEKWVQDAMKHLDHQAAALTKNG |
| Sequence Similarities | Belongs to the intercrine delta family. |
| Amino Acids | 25 to 100 |
| Cellular Localization | Secreted and Cell membrane. |
| Tissue Specificity | Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. |
| Function | The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 9 kDa |
| Purity | >95% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |