Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse CD367/CLEC4A Protein

Cat. No.: IBDP-531504

Size:

Target Information

Synonyms Clec4a|||Clec4a2|||Clecsf6|||DcirC-type lectin domain family 4 member A|||C-type lectin superfamily member 6|||Dendritic cell immunoreceptor|||CD antigen CD367
Sequence QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag His, Myc, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 39.6 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.