Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse CD3 epsilon Protein

Cat. No.: IBDP-530675

Size:

Target Information

Synonyms Cd3eT-cell surface glycoprotein CD3 epsilon chain|||T-cell surface antigen T3/Leu-4 epsilon chain|||CD antigen CD3e
Sequence DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Product Details

Product Type Protein
Species Mouse
Source P. pastoris
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 11.9 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.