Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse CCL4/MIP-1 beta Protein

Cat. No.: IBDP-531180

Size:

Target Information

Sequence APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQI CANPSEPWVTEYMSDLELN
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 24 to 92
Cellular Localization Secreted.
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

Product Details

Product Type Protein
Species Mouse
Source E. coli
Endotoxin Level ≤1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 8 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.