Cat. No.: IBDP-530128
Size:
Online InquiryTarget Information
Sequence | QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVC GNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNST SVRSATLGHPRMVMMPRKTNN |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 24 to 144 |
Cellular Localization | Secreted. |
Tissue Specificity | Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine. |
Function | Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | E. coli |
Protein Length | Full length protein |
Molecular Weight | 14 kDa |
Purity | >95% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |