Recombinant Mouse C5 Protein

Target Information

Sequence	NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLC IRAFNECCTIANKIRKESPHKPVQLGR
Sequence Similarities	Contains 1 anaphylatoxin-like domain. Contains 1 NTR domain.
Amino Acids	679 to 755
Cellular Localization	Secreted.
Function	Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C5a also stimulates the locomotion of polymorphonuclear leukocytes (chemokinesis) and direct their migration toward sites of inflammation (chemotaxis).

Product Details

Product Type	Protein
Species	Mouse
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Protein fragment
Molecular Weight	9 kDa
Purity	≥95%
Active	No
Animal free	Yes
Nature	Recombinant
Application	HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.