Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse B7-H4 Protein

Cat. No.: IBDP-532702

Size:

Target Information

Synonyms B7 homolog 4|||Protein B7S1|||B7-H4
Sequence FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRSSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGP
Function B7-H4 Protein, Mouse (HEK293, Fc) may participate in negative regulation of cell-mediated immunity in peripheral tissues. Cell-associated B7-H4 could also inhibit T cell response. B7-H4 acts as a morphogenic factor for cancer cells.

Product Details

Product Type Protein
Species Mouse
Source HEK 293 Cells
Tag Fc Tag
Endotoxin Level <1.0 Eu/µg
Molecular Weight 70-90 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.