Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse B7-2/CD86 Protein

Cat. No.: IBDP-530832

Size:

Target Information

Synonyms rMuB7-2, His|||T-lymphocyte activation antigen CD86|||Activation B7-2 antigen|||Early T-cell costimulatory molecule 1|||ETC-1|||CD86
Sequence VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKHHHHHH
Function B7-2/CD86 Protein, Mouse (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation.

Product Details

Product Type Protein
Species Mouse
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40-60 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.