Cat. No.: IBDP-530125
Size:
Online InquiryTarget Information
| Synonyms | soluble Receptor Activator of NF-kB Ligand|||TNFSF11|||TRANCE (TNF-Related Activation-induced Cytokine)|||OPGL|||ODF (Osteoclast Differentiation Factor)|||CD254|||sRNAK Ligand |
| Sequence | MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Function | RANKL (TNFSF11), a type II transmembrane protein, is a receptor ligand for NF-κB (RANK). RANKL is an activator of NF-κB. When binding to NF-κB, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). Animal-Free RANK L/TNFSF11 Protein, Mouse (His) is a recombinant mouse RANKL (P143-D316) with C-terminal His tag, which is produced in E.coli. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | His |
| Endotoxin Level | <0.1 Eu/μg |
| Molecular Weight | 20.35 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |