Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse Animal-Free CCL4 Protein

Cat. No.: IBDP-530516

Size:

Target Information

Synonyms Ccl4|||Mip1b|||Scya4|||C-C motif chemokine 4|||Immune activation protein 2|||ACT-2|||ACT2|||Macrophage inflammatory protein 1-beta|||MIP-1-beta|||Protein H400|||SIS-gamma|||Small-inducible cytokine A4
Sequence APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag His
Endotoxin Level <0.1 Eu/μg
Molecular Weight 8.64 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.