Recombinant Human VEGFC Protein

Target Information

Sequence	AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYR CGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRC MSKLDVYRQVHSIIRR
Sequence Similarities	Belongs to the PDGF/VEGF growth factor family.
Amino Acids	112 to 227
Cellular Localization	Secreted.
Tissue Specificity	Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
Function	Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	46 kDa
Purity	≥95%
Active	Yes
Animal free	No
Nature	Recombinant
Application	Biological Activity, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.