Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human VEGF165 Protein

Cat. No.: IBDP-530559

Size:

Target Information

Synonyms VEGF-AA|||rHuVEGF165|||VPF|||Folliculostellate cell-derived growth factor|||Glioma-derived endothelial cell mitogen
Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Function VEGF165 Protein (HEK293) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 17-26 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.