Cat. No.: IBDP-530566
Size:
Online InquiryTarget Information
| Synonyms | VEGF-AA|||rHuVEGF165|||VPF|||Folliculostellate cell-derived growth factor|||Glioma-derived endothelial cell mitogen |
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Function | VEGF165 Protein (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | P. pastoris |
| Tag | Tag Free |
| Endotoxin Level | <0.5 Eu/μg |
| Molecular Weight | 38.2 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |