Recombinant Human ULBP2 Protein

Target Information

Sequence	GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS PLGKKLNVTT AWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHS SGSWQFSFDG QIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLE DFLMGMDSTL EPSAGAPLAMSSVDHHHHHH
Sequence Similarities	Belongs to the MHC class I family.
Amino Acids	26 to 217
Cellular Localization	Cell membrane. Secreted.
Tissue Specificity	Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
Function	Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	23 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.