Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human ULBP2 Protein

Cat. No.: IBDP-531413

Size:

Target Information

Sequence ADPGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVT PVSPLGKKLNVTTAWKAQNP VLREVVDILT EQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMD STLEPSAGAPLAMSHHHHHH
Sequence Similarities Belongs to the MHC class I family.
Amino Acids 26 to 216
Cellular Localization Cell membrane. Secreted.
Tissue Specificity Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
Function Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Product Details

Product Type Protein
Species Human
Source Baculovirus Infected Insect Cells
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 23 kDa
Purity >90%
Active No
Animal free No
Nature Recombinant

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.