Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TSLP R Protein

Cat. No.: IBDP-531444

Size:

Target Information

Synonyms CRL2|||CRL2cytokine receptor CRL2 precusor|||CRLF2|||CRLF2Y|||CRLM-2|||Cytokine receptor-like 2|||cytokine receptor-like factor 2|||ILXR|||IL-XR|||P2RY8/CRLF2 fusion|||PCOR1|||TSLP R|||TSLP receptor|||TSLPR
Sequence GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 35-50 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.