Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TSC-1 Protein

Cat. No.: IBDP-531541

Size:

Target Information

Sequence TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVC THPRKKWVQKYISLLKTPKQL
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 24 to 94
Cellular Localization Secreted.
Tissue Specificity Ubiquitously expressed at low levels in various tissues including heart and ovary.
Function Chemotactic for eosinophils and basophils. Binds to CCR3.

Product Details

Product Type Protein
Species Human
Source E. coli
Endotoxin Level <0.05 Eu/µg
Protein Length Full length protein
Molecular Weight 8 kDa
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.