Cat. No.: IBDP-531541
Size:
Online InquiryTarget Information
| Sequence | TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVC THPRKKWVQKYISLLKTPKQL |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 24 to 94 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Ubiquitously expressed at low levels in various tissues including heart and ovary. |
| Function | Chemotactic for eosinophils and basophils. Binds to CCR3. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | <0.05 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 8 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |