Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TROP-2 Protein

Cat. No.: IBDP-530401

Size:

Target Information

Synonyms Tumor-associated calcium signal transducer 2|||Membrane component chromosome 1 surface marker 1|||Cell surface glycoprotein Trop-2|||TACSTD2|||TROP2
Sequence HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Avi, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40-60 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.