Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TROP-2 Protein

Cat. No.: IBDP-530400

Size:

Target Information

Synonyms Cell surface glycoprotein Trop 2|||Cell surface glycoprotein Trop-2|||Cell surface glycoprotein Trop2|||Epithelial glycoprotein 1|||GA733 1|||GA7331|||M1S 1|||M1S1|||Membrane component chromosome 1 surface marker 1|||Pancreatic carcinoma marker protein GA733 1 |||Pancreatic carcinoma marker protein GA733-1|||Pancreatic carcinoma marker protein GA7331 |||TACD 2|||TACD2_HUMAN|||TACSTD 2|||Tacstd2|||Trop 2|||Trop2|||Tumor associated calcium signal transducer 2 precursor |||Tumor-associated calcium signal transducer 2
Sequence HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 56.8 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.