Cat. No.: IBDP-531733
Size:
Online InquiryTarget Information
Sequence | MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAW CRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNL QPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESF EDAHVEHSISRPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQD SSSQRPLGCSLAWTEARDTSTQ |
Sequence Similarities | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Amino Acids | 1 to 222 |
Cellular Localization | Secreted and Cell membrane. |
Tissue Specificity | Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord. |
Function | May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. |
Product Details
Product Type | Protein |
Species | Human |
Source | Wheat Germ |
Tag | GST |
Protein Length | Full length protein |
Animal free | No |
Nature | Recombinant |
Application | ELISA, WB |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |