Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TLT-1 Protein

Cat. No.: IBDP-531267

Size:

Target Information

Sequence QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH
Sequence Similarities Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Amino Acids 16 to 162
Cellular Localization Cell membrane. Cytoplasm. Sequestered in cytoplasmic vesicles in resting platelets. Transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis.
Tissue Specificity Detected in platelets, monocytic leukemia and in T-cell leukemia.
Function Cell surface receptor that may play a role in the innate and adaptive immune response.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Protein fragment
Molecular Weight 17 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.