Cat. No.: IBDP-531267
Size:
Online InquiryTarget Information
Sequence | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH |
Sequence Similarities | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Amino Acids | 16 to 162 |
Cellular Localization | Cell membrane. Cytoplasm. Sequestered in cytoplasmic vesicles in resting platelets. Transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis. |
Tissue Specificity | Detected in platelets, monocytic leukemia and in T-cell leukemia. |
Function | Cell surface receptor that may play a role in the innate and adaptive immune response. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Protein fragment |
Molecular Weight | 17 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |