Recombinant Human TLR5 Protein

Target Information

Sequence	LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPD VFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSF SGVSLFSLSTEGCDEEEV
Sequence Similarities	Belongs to the Toll-like receptor family. Contains 22 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 TIR domain.
Amino Acids	517 to 634
Cellular Localization	Membrane.
Tissue Specificity	Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
Function	Participates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Protein Length	Protein fragment
Molecular Weight	39 kDa
Active	No
Animal free	No
Nature	Recombinant
Application	ELISA, SDS-PAGE, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.