Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TIM-4/TIMD-4 Protein

Cat. No.: IBDP-532815

Size:

Target Information

Synonyms T-cell immunoglobulin and mucin domain-containing protein 4|||TIMD-4|||T-cell immunoglobulin mucin receptor 4|||TIM-4|||T-cell membrane protein 4|||TIMD4|||TIM4
Sequence ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 60-90 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.