Recombinant Human TGF beta 1 Protein

Target Information

Sequence	ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS
Sequence Similarities	Belongs to the TGF-beta family.
Amino Acids	279 to 390
Cellular Localization	Secreted > extracellular space > extracellular matrix.
Tissue Specificity	Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Function	Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Product Details

Product Type	Protein
Species	Human
Source	CHO Cells
Endotoxin Level	<0.1 Eu/μg
Protein Length	Protein fragment
Molecular Weight	25 kDa
Purity	>98%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.