Cat. No.: IBDP-530189
Size:
Online InquiryTarget Information
Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS |
Sequence Similarities | Belongs to the TGF-beta family. |
Amino Acids | 279 to 390 |
Cellular Localization | Secreted > extracellular space > extracellular matrix. |
Tissue Specificity | Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage. |
Function | Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Protein Length | Full length protein |
Molecular Weight | 13 kDa |
Purity | >98% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |