Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human TFF1 Protein

Cat. No.: IBDP-530243

Size:

Target Information

Synonyms TFF1|||BCEI|||D21S21|||HP1.A|||HPS2|||pNR-2|||pS2|||trefoil factor 1|||gastrointestinal trefoil protein pS2|||breast cancer estrogen-inducible sequence|||Breast cancer estrogen-inducible protein|||breast cancer, estrogen-inducible sequence expressed in gastrointestinal trefoil protein pS2|||pS2 protein|||trefoil factor, BCE1 pS2 induced by estrogen from human breast cancer cell line M
Sequence EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Product Details

Product Type Protein
Species Human
Source P. pastoris
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 8.7 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.