Cat. No.: IBDP-531350
Size:
Online InquiryTarget Information
| Synonyms | rHuCCL17, His|||C-C motif chemokine 17|||CC chemokine TARC|||Small-inducible cytokine A17|||Thymus and activation-regulated chemokine|||CCL17|||SCYA17|||TARC |
| Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSHHHHHH |
| Function | TARC/CCL17 Protein (HEK293, His) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein (HEK293, His) is a recombinant human TARC/CCL17(A24-S94) protein expressed by HEK293 with a his tag at C end. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 13 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |