Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human SOCS1 Protein

Cat. No.: IBDP-530115

Size:

Target Information

Sequence MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAP GDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGT FLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL RDYLSSFPFQI
Sequence Similarities Contains 1 SH2 domain. Contains 1 SOCS box domain.
Amino Acids 1 to 211
Tissue Specificity Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.
Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival (By similarity). Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2.

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His
Protein Length Full length protein
Molecular Weight 28 kDa
Purity >90%
Active No
Animal free No
Nature Recombinant
Application MS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.