Recombinant Human SLPI Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSD WQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNF CEMDGQCKRDLKCCMGMCGKSCVSPVKA
Sequence Similarities	Contains 2 WAP domains.
Amino Acids	26 to 132
Cellular Localization	Secreted.
Tissue Specificity	Mucous fluids.
Function	Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	14 kDa
Purity	≥80%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.