Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human SH2D1A Protein

Cat. No.: IBDP-530146

Size:

Target Information

Synonyms SH2 Domain-Containing Protein 1A|||Duncan Disease SH2-Protein|||Signaling Lymphocytic Activation Molecule-Associated Protein|||SLAM-Associated Protein|||T-Cell Signal Transduction Molecule SAP|||SH2D1A|||DSHP|||SAP
Sequence MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 16.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.