Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human SDF-1 alpha/CXCL12 Protein

Cat. No.: IBDP-530866

Size:

Target Information

Synonyms Stromal Cell-Derived Factor 1|||SDF-1|||hSDF-1|||C-X-C Motif Chemokine 12|||Intercrine Reduced in Hepatomas|||IRH|||hIRH|||Pre-B Cell Growth-Stimulating Factor|||PBSF|||CXCL12|||SDF1|||SDF1A|||SDF1B
Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 10.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.